Loading...
Statistics
Advertisement

WHEY PROTEIN INFO | IN WHEY WE TRUST
www.whey-protein-info.com/
IN WHEY WE TRUST

Whey-protein-info.com

Advertisement
Whey-protein-info.com is hosted in United States / San Francisco . Whey-protein-info.com uses HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 0. Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Whey-protein-info.com

Technology

Number of occurences: 9
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • Shortcodes

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • widgets.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 1
  • Twitter Button

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Whey-protein-info.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 297595277161820265874349418054836283398813
    • validFrom: 160404130800Z
    • validTo: 160703130800Z
    • validFrom_time_t: 1459775280
    • validTo_time_t: 1467551280
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: ED:4E:EE:D6:E8:26:D4:AA:ED:70:52:76:0F:DE:02:20:99:C7:38:B6
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:tls.automattic.com, DNS:whetstoneandassociates.com, DNS:whetstoneathletics.com, DNS:whetyourwanderlust.com, DNS:whetyourwoman.com, DNS:whetzgood.com, DNS:whey-protein-info.com, DNS:wheyinonthecurds.com, DNS:wheymouthbohemian.com, DNS:whf-pa.org, DNS:whfarmacy.com, DNS:whgoftampa.com, DNS:whhealthandfitness.com, DNS:whichcraftandwhimsy.com, DNS:whichdigitalblog.com, DNS:whichhalfoftheglass.com, DNS:whichmitch.com, DNS:whichonesam.com, DNS:whichsailboat.com, DNS:whichshoestoday.com, DNS:whichwayisup.me, DNS:whichwaytomongolia.com, DNS:whidbeybicycleclub.org, DNS:whidbeycarenet.org, DNS:whidbeyfocus.com, DNS:whidbeyislandcarpentry.com, DNS:whidbeyislandelectricbikerentals.com, DNS:whidbeyislandgirl.net, DNS:whidbeyislandtreasurehunt.com, DNS:whidbeyislandyoga.com, DNS:whidbeymothermentors.org, DNS:whidbeystudents.com, DNS:whidbeywildlifehabitat.com, DNS:whiffofcordite.com, DNS:whifftestbuddysystem.com, DNS:while-here.com, DNS:while-you-were-sleeping.com, DNS:whileatoxford.com, DNS:whileatthezoo.com, DNS:whileawaytheday.com, DNS:whileawaythehoursblog.com, DNS:whiledarceysleeps.com, DNS:whileguide.com, DNS:whilehavingtea.com, DNS:whileiamthinkingaboutit.com, DNS:whileifelse.com, DNS:whileimwaitingblog.com, DNS:whileinaustralia.com, DNS:whileinheels.com, DNS:whileiwasreading.com, DNS:whilemaandpawsawaypetservices.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Whey-protein-info.com

Number of occurences: 10
  • Name:
    Content: de_DE
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: application-name
    Content: WHEY PROTEIN INFO
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: IN WHEY WE TRUST
  • Name: msapplication-task
    Content: name=WordPress.com-Foren;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: WHEY PROTEIN INFO bei WordPress.com
  • Name: description
    Content: IN WHEY WE TRUST

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns3.wordpress.com
  • ns2.wordpress.com
  • ns1.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Sat, 09 Apr 2016 20:03:00 GMT Content-Type: text/html Content-Length: 178 Connection: keep-alive Location: https://whey-protein-info.com/ X-ac: 3.ams _dca HTTP/1.1 200 OK Server: nginx Date: Sat, 09 Apr 2016 20:03:01 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.ams _dca

DNS

host: whey-protein-info.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: whey-protein-info.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: whey-protein-info.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: whey-protein-info.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: whey-protein-info.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: whey-protein-info.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hey-protein-info.com, www.w hey-protein-info.com, www. hey-protein-info.com, www.wchey-protein-info.com, www.chey-protein-info.com, www.whey-protein-info.com, www.hey-protein-info.com, www.wdhey-protein-info.com, www.dhey-protein-info.com, www.wfhey-protein-info.com, www.fhey-protein-info.com, www.wghey-protein-info.com, www.ghey-protein-info.com, www.wbhey-protein-info.com, www.bhey-protein-info.com, www.wey-protein-info.com, www.wheey-protein-info.com, www.weey-protein-info.com, www.whdey-protein-info.com, www.wdey-protein-info.com, www.whcey-protein-info.com, www.wcey-protein-info.com, www.whuey-protein-info.com, www.wuey-protein-info.com, www.whjey-protein-info.com, www.wjey-protein-info.com, www.whey-protein-info.com, www.wey-protein-info.com, www.whbey-protein-info.com, www.wbey-protein-info.com, www.whgey-protein-info.com, www.wgey-protein-info.com, www.why-protein-info.com, www.whexy-protein-info.com, www.whxy-protein-info.com, www.whesy-protein-info.com, www.whsy-protein-info.com, www.whewy-protein-info.com, www.whwy-protein-info.com, www.whery-protein-info.com, www.whry-protein-info.com, www.whefy-protein-info.com, www.whfy-protein-info.com, www.whevy-protein-info.com, www.whvy-protein-info.com, www.whecy-protein-info.com, www.whcy-protein-info.com, www.wheqy-protein-info.com, www.whqy-protein-info.com, www.wheay-protein-info.com, www.whay-protein-info.com, www.wheyy-protein-info.com, www.whyy-protein-info.com, www.whe-protein-info.com, www.wheyz-protein-info.com, www.whez-protein-info.com, www.wheya-protein-info.com, www.whea-protein-info.com, www.wheys-protein-info.com, www.whes-protein-info.com, www.wheyd-protein-info.com, www.whed-protein-info.com, www.whey-protein-info.com, www.whe-protein-info.com, www.wheyc-protein-info.com, www.whec-protein-info.com, www.whey -protein-info.com, www.whe -protein-info.com, www.wheyprotein-info.com, www.whey-tprotein-info.com, www.wheytprotein-info.com, www.whey-gprotein-info.com, www.wheygprotein-info.com, www.whey-hprotein-info.com, www.wheyhprotein-info.com, www.whey-uprotein-info.com, www.wheyuprotein-info.com, www.whey-jprotein-info.com, www.wheyjprotein-info.com, www.whey-xprotein-info.com, www.wheyxprotein-info.com, www.whey-sprotein-info.com, www.wheysprotein-info.com, www.whey-aprotein-info.com, www.wheyaprotein-info.com, www.whey-protein-info.com, www.wheyprotein-info.com, www.whey- protein-info.com, www.whey protein-info.com, www.whey-rotein-info.com, www.whey-pirotein-info.com, www.whey-irotein-info.com, www.whey-pkrotein-info.com, www.whey-krotein-info.com, www.whey-purotein-info.com, www.whey-urotein-info.com, www.whey-pjrotein-info.com, www.whey-jrotein-info.com, www.whey-plrotein-info.com, www.whey-lrotein-info.com, www.whey-potein-info.com, www.whey-priotein-info.com, www.whey-piotein-info.com, www.whey-prootein-info.com, www.whey-pootein-info.com, www.whey-prlotein-info.com, www.whey-plotein-info.com, www.whey-prlotein-info.com, www.whey-plotein-info.com, www.whey-pr.otein-info.com, www.whey-p.otein-info.com, www.whey-prtein-info.com, www.whey-probtein-info.com, www.whey-prbtein-info.com, www.whey-prohtein-info.com, www.whey-prhtein-info.com, www.whey-progtein-info.com, www.whey-prgtein-info.com, www.whey-projtein-info.com, www.whey-prjtein-info.com, www.whey-promtein-info.com, www.whey-prmtein-info.com, www.whey-pro tein-info.com, www.whey-pr tein-info.com, www.whey-provtein-info.com, www.whey-prvtein-info.com, www.whey-proein-info.com, www.whey-protqein-info.com, www.whey-proqein-info.com, www.whey-protaein-info.com, www.whey-proaein-info.com, www.whey-prot ein-info.com, www.whey-pro ein-info.com, www.whey-protwein-info.com, www.whey-prowein-info.com, www.whey-proteein-info.com, www.whey-proeein-info.com, www.whey-protzein-info.com, www.whey-prozein-info.com, www.whey-protxein-info.com, www.whey-proxein-info.com, www.whey-protcein-info.com, www.whey-procein-info.com, www.whey-protin-info.com, www.whey-protexin-info.com, www.whey-protxin-info.com, www.whey-protesin-info.com, www.whey-protsin-info.com, www.whey-protewin-info.com, www.whey-protwin-info.com, www.whey-proterin-info.com, www.whey-protrin-info.com, www.whey-protefin-info.com, www.whey-protfin-info.com, www.whey-protevin-info.com, www.whey-protvin-info.com, www.whey-protecin-info.com, www.whey-protcin-info.com, www.whey-proteqin-info.com, www.whey-protqin-info.com, www.whey-proteain-info.com, www.whey-protain-info.com, www.whey-proteyin-info.com, www.whey-protyin-info.com,

Other websites we recently analyzed

  1. Transequity - Welcome to our website
    For the first time in South Africa we have the exclusive right to introduce you to an oppurtunity of owning a historically stable and risk free ivestment and store of value and ultimate welath. Own your own portion of Gold and Silver. These are precious metals that have consistently offered great returns to those who have accumulated them over time and as they offer a perfect method of saving.
    South Africa - 196.22.142.175
    Server software: Apache
    Technology: CSS, Html, Iframe, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 3
  2. Ferienwohnung & Appartements, Hanneshof Resort, Filzmoos
    Hanneshof Resort mit Appartement Anneliese Ferienwohnungen Maier sowie Raika Apartments einen Traumurlaub in Filzmoos im Land Salzburg, Österreich.
    Austria - 213.208.134.185
    Server software: Apache/2.2.15 (Fedora)
    Technology: CSS, Google Font API, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 2
  3. b-und-b-im-web.de steht zum Verkauf
    Germany - 176.9.83.229
    Server software: lighttpd/1.4.18
    Technology: CSS, Html, Html5, Iframe, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  4. Traffic School in Santa Ana, CA | Ahora Mismo TVS Traffic School Spanish/ English (714) 552-9990
    If you are looking for a reliable traffic school in Santa Ana, contact Ahora Mismo TVS Traffic School Spanish/ English today! We work with traffic tickets, DUI tickets and non insurance tickets.
    Ashburn (United States) - 54.86.179.39
    Server software: nginx/1.6.0
    Technology: CloudFront, Maxcdn, OSS CDN, CSS, Google Font API, Html, Html5, Javascript, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 4
  5. 3000034.com
    United Kingdom - 85.233.160.22
    Server software: Apache
    Technology: Html, Javascript, Php
    Number of meta tags: 1
  6. 35468.com
    New York (United States) - 69.172.201.153
    Server software: DOSarrest
    Technology: Html, Javascript
    Number of meta tags: 1
  7. Binero Webbhotell - vänligast på webben
    Sweden - 195.74.38.62
    Server software: Apache
    Technology: Html, Iframe
    Number of meta tags: 1
  8. Kaszuba Family Golf Outing | October 3rd, 2015 | Sea Oaks Golf Club, Little Egg Harbor, New Jersey
    Scottsdale (United States) - 173.201.198.128
    Server software: Apache
    Technology: CSS, Google Font API, Gravatar, Html, Html5, Javascript, jQuery, jQuery Colorbox, jQuery UI, Php, Pingback, WordPress Stats, Wordpress
    Number of Javascript: 28
    Number of meta tags: 4
  9. Doug Stanley
    Check out this GoDaddy hosted webpage! http://dougstanley.net.
    Scottsdale (United States) - 97.74.42.79
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Javascript, jQuery, jQuery UI
    Number of Javascript: 4
    Number of meta tags: 3
  10. The Cat's Meow NW - Cat Boarding Services Seattle Area
    The Cat's Meow NW - Serving Greater Seattle and all of Western Washington! Cat boarding with love all the care and personal attention I your pet needs.
    Houston (United States) - 192.185.120.210
    Server software: nginx/1.10.1
    Technology: CSS, Font Awesome, Gravatar, Html, Javascript, jQuery, jQuery Colorbox, jQuery Hover Intent, Php, Pingback, Spin.js, WordPress Stats, Wordpress, Facebook Box, Google +1 Button, Linkedin Share button
    Number of Javascript: 46
    Number of meta tags: 9

Check Other Websites